PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.H36I7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 353aa    MW: 39515.1 Da    PI: 8.1648
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.H36I7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.2e-32146199255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Araip.H36I7 146 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 199
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15143200IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-28144200IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23146199IPR006447Myb domain, plants
PfamPF002492.3E-7147198IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MKATTPPPYT AMPIQMQSFS SSALLAEPDL SLNISPPFLS AKGTFKDMCS SISDSGSSGS  60
DASHDNNNNN NNCFFHHTHT VPQPTLTLGS GPASNLNHHH HYHHLHQYPM QGLSRNYFNH  120
HPHQPQIHCR SDFKRNGGGR RSMRAPRMRW TTTLHAHFVH AVQLLGGHER ATPKSVLELM  180
NVKDLTLAHV KSHLQMYRTV KSTDKVPGNN NNNNNLGDAL AVVCNGHKVD MGFEQQRQEV  240
VVDHLHAQRG LLQHPLVQLQ QSQRSSCQSP LLETNTNITR QKPDISFVYS RLQDGNEIMN  300
NHGGLSNYLK MKESSDCNNL SSDSEGVIDL EFTLGRPTHH QDESSRELTL LKC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016165046.10.0PREDICTED: probable transcription factor KAN4
TrEMBLI1MXS73e-74I1MXS7_SOYBN; Uncharacterized protein
STRINGGLYMA17G36500.19e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.14e-45G2-like family protein